Краткое содержание страницы № 1
Краткое содержание страницы № 2
Using the Instruction Manual ThankyouforpurchasingthisDigitalPiano.Theuseofhightechnologyandthemostadvanced samplingtechniquebringsyouhighqualitysoundandenjoyment.Thecombinationofdigitalpiano andelectronickeyboardfeaturesletyouperformperfectly.Wehopethisskilfullybuiltdigitalpiano willabletoexploreyourcreativity,andbringsyouunlimitedhappinessandmusicenjoyment. Beforeyouusethepiano,werecommendyoutoreadthroughthismanual.Pleasekeepthis instructionmanualforfuturereference. Precautions Pleasereadthefo
Краткое содержание страницы № 3
Contents 22 DigitalPianoSet-upGuide 3-5 MIDI 22 -MIDIchannelselection GeneralGuide 6-7 22 -Controlchangefilter TheConnectors 8-9 23 Specifications -UsingtheACpowerjack 8 23 Troubleshooting -Usingheadphones 8 -UsingAUX.OUTjack 8 24-27 Appendix -Usingthefootpedals 9 -Appendix1A-SingleFingerChord -UsingtheMIDIIN/OUTjacks 9 Chart 24 BasicOperation 10 -Appendix1B-FingeredChordChart 25 1.Powerswitch&volume 10 -Appendix2-StyleList 25 2.Demonstration 10 -Appendix3-VoiceList 25 -Appendix4-DemoSongList Vo
Краткое содержание страницы № 4
Digital Piano Set-up Guide 1.Openthepackage,andcheckwhetherthefollowingpartsareavailable: 1.Pianobody 6.Footpedalunit 2.Musicstand 7.Handscrew(4pcs.) 3.Rightlegcomponent 8.Screws(8pcs.) 4.Leftlegcomponent 9.Screwcaps(8pcs.) 5.Centersupportingboard 10.Powercablestablinghook(2pcs.) 1 2 7 10 3 5 8 9 6 4 3
Краткое содержание страницы № 5
Digital Piano Set-up Guide...............Continued 2.Followtheillustrationbelowandfinishofftheset-upprocedures. 7 9 8 7 8 9 8 9 Partsrequiredinthis 9 8 step: 7.Handscrewsx4 8.Screwsx8 9.Screwcapsx8 Caution: Whensettingupthepiano,pleaseusethescrewssuppliedandavoidusingthe unspecifiedscrewswhichmaydamagethepianobodyorcausingthelostof stability. A. Putthefootpedalunit(6)inbetweentheleftandrightlegscomponents(3&4),use4pieces ofscrews(2oneachside)tostablethelegsontothefootpedalunit. (Makesurethedirec
Краткое содержание страницы № 6
Digital Piano Set-up Guide...............Continued B. Use 4 pieces of screws (2 on each side) to stable the center supporting board (5) onto the assembly finished in Part A on the previous page. C. Put the piano body(1) on the top of the assembly finished in part B, use 4 pieces of hand screws to stable afterward. D. After the initial set-up, stick the cable stabling hook(10) on the internal side of the leg component (see the below illustration for reference). Cable stabling hook 5
Краткое содержание страницы № 7
General Guide 1 9 6 Top View 10 23 4 5 Rear View 78 Front View 1 6 Control Panel Headphones Jack 2 7 Pedal Jack Soft Pedal 3 8 MIDI IN/OUT Jack Sustain Pedal 4 9 AUX. OUT Jack Music Stand 5 10 AC Power Jack Piano Keyboard 6
Краткое содержание страницы № 8
General Guide..............Continued 123 19 28 1 5 44 3 22 1 1 B A 5 7 18 13 6 910 REVERB CHORUS 11 12 13 NORMAL11 7 6 5 14 HARMONY FINGERED 22 9 10 15 OCTAVE DOWN S. FINGER 33 8 TOUCH SPLIT 16 44 17 18 17 8 20 4 12 14 15 27 16 25 11 21 29 23 22 24 26 1 7 21 POWER SWITCH JAM TRACK INDICATOR PANEL MEMORY 22 2 8 MASTER VOLUME NUMERIC KEYPAD SPLIT 23 3 9 MIXER CONTROL VOICE SELECT OCTAVE DOWN 10 24 - LOWER STYLE SELECT TOUCH 25 11 - UPPER OTS DUAL 26 12 - OC1, OC2, OC3 TEMPO +/- HARMONY 13 27 - BAS
Краткое содержание страницы № 9
The Connectors Using the AC power jack ON 1. Connect the power 2. Ensure the piano cable to the AC power is turned off when OFF jack on the underside connecting and POWER of the piano body. disconnecting the power. 3. Turn the volume switch 4. Plug the power cable anti-clockwise to reach into an AC power the minimum volume outlet. level. 5. If you have done the above procedures you are now safe to turn on the piano. Caution: When the piano is not in use or during a thunderstorm, disconnect the p
Краткое содержание страницы № 10
The Connectors..................Continued Using the Foot Pedals Connect the plug of the foot pedal unit to the pedal jack on the rear panel. You will experience the sustain effect. Using the MIDI IN/OUT Jack MIDI stand for Musical Instrument Digital Interface. MIDI is a world wide standard that makes it possible for various electronic musical instruments and other devices. MIDI IN: Data transmitted from other MIDI instrument via MIDI, is received at this terminal. MIDI OUT: Data produced by the
Краткое содержание страницы № 11
Basic Operation 1. Power Switch & Volume 1. Turn the POWER switch on. 2. Use the volume control ON The LCD display light up. switch to adjust the OFF volume to your desired level POWER Note: If the LCD display has not light up after you turned on the piano, please check the power supply. If the piano is silent, the volume may be adjusted to its minimum level. 2. Demonstration This Digital Piano comes with 10 demo songs HARMONY for showing you the possibilities of the piano. OCTAVE DOWN TOUCH To
Краткое содержание страницы № 12
Voices and Effects...........Continued 2. Dual Voice This digital piano features dual voice option which allow you to hear two different sounds for every note played. 1. When VOICE 1 is showing on the display, HARMONY press the DUAL button, a word VOICE 2 OCTAVE DOWN TOUCH appears in the display. Now input the second voice digits. 2. Press the DUAL button again to turn this HARMONY OCTAVE DOWN function off, and the word VOICE 1 appears TOUCH in the display. Note: Dual Voice function only working
Краткое содержание страницы № 13
Voices and Effects...........Continued 4. Drum Kit This digital piano features 7 percussion sounds. Voices 141-147 are the featuring drum set of this digital piano. To select a drum set, please refer to the section "Select a Voice" on page 10. 5. Digital Effects This digital drum has 8 Reverb and 8 Chorus effects. This function can adjust the reverb and chorus effect by referring to the performing environment. Reverb effect To adjust reverb type and levels: HARMONY HARMONY 1. Press the REVERB bu
Краткое содержание страницы № 14
Voices and Effects...........Continued 6. Instant select Piano voice You can select the piano voices immediately by pressing the PIANO button. When you press the PIANO button, the digital piano turns into Normal status automatically, at this time Dual voice function is unable to start. Press the PIANO button again to exit the PIANO mode and return to the previously selected voice. If you select a voice directly in the Piano status, the PIANO status will be exit automatically. Touch Response Keyb
Краткое содержание страницы № 15
Split Keyboard To play on a split keyboard with one or two voices on the right section (Upper keyboard) and one voice on the left (Lower keyboard), press the MODE button as many times as necessary until the arrowhead points to the SPLIT function. NORMAL FINGERED HARMONY S.FINGER OCTAVE DOWN SPLIT TOUCH Select a Split Point 1. Press and hold the SPLIT POINT button. The display shows the current Split point setting expressed as a note of the keyboard, together with the number of the Voice assigned
Краткое содержание страницы № 16
Playing the Styles.............Continued 2. The Chord Recognition Modes The digital piano allows you to choose between two different Chord modes: Fingered and Single Finger. Single Finger mode 1.Choose a style that you desired (01-99). NORMAL FINGERED HARMONY 2.Press the MODE button until the arrowhead S.FINGER OCTAVE DOWN SPLIT TOUCH points to S.Finger. A B 3.Press the START/STOP button to start to playback the style. 4.Follow the Single Finger Chord table in the appendix section and play the c
Краткое содержание страницы № 17
Playing the Styles.............Continued 3. Accompaniment Control This digital piano provides a wide variety of automatic functions that make itself very easy to play. The functions are found in the Accompaniment Control section. START/STOP A B Press the START/STOP button to start/stop the style. SYNC 1. The SYNC function allows you to synchronize the start of your Style with a note or chord A B pressed on the keyboard without using the START/STOP button. When you press the SYNC button, the disp
Краткое содержание страницы № 18
Playing the Styles.............Continued ENDING You can stop your Style automatically with A B a well-executed ending pattern without using the START/STOP button. While the Style is playing, simply press the ENDING button. The Style auto-accompaniment stops automatically with an Ending phrase. Metronome At any time, you can activate the METRONOME for practising purposes. 1. To play with the Metronome, press the STYLE button and insert the value "00". x2 Beat Metronome Indicator Type DUAL 2. Pres
Краткое содержание страницы № 19
One Touch Setting The One Touch Setting is a quick and easy way of reconfiguring voices of Upper and Lower sections of a style by pressing only one button while you are playing. Selecting the One Touch Setting 1.Select a Style using the methods already described. From Normal 2.Press the OTS button. The display shows an DUAL NORMAL switch to FINGERED HARMONY Fingered arrowhead pointing to the OTS indicator. S.FINGER OCTAVE DOWN SPLIT TOUCH Make sure one of the two chord recognition mode is select
Краткое содержание страницы № 20
The Sequencer The digital piano hasa3tracks recording function, you can record in Voice mode or Style mode with one or two melody tracks. In the playback, you can play along with the recorded sequence using different voices to those used in the Melody tracks. 1. Set the piano to STYLE mode and select a Style. 2. Press the RECORD button. The LED of the RECORD The flashing Beat indicators button starts to flash and the KEY START function activates automatically (the Beat indicators start to flash)